ELOV4_MOUSE Q9EQC4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9EQC4
Recommended name：Elongation of very long chain fatty acids protein 4
EC number：EC 2.3.1.199
Alternative names：(3-keto acyl-CoA synthase Elovl4) (ELOVL fatty acid elongase 4) (ELOVL FA elongase 4) (Very long chain 3-ketoacyl-CoA synthase 4) (Very long chain 3-oxoacyl-CoA synthase 4)
Cleaved into：
GeneID：83603
Gene names (primary )：Elovl4
Gene names (synonym )：
Gene names (ORF )：
Length：312
Mass：36506
Sequence：MGLLDSEPGSVLNAMSTAFNDTVEFYRWTWTIADKRVADWPLMQSPWPTISISTLYLLFVWLGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRELFMGSYNAGYSYICQSVDYSNDVNEVRIAGALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQAFFGAQMNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQLVQFHVTIGHTALSLYTDCPFPKWMHWALIAYAISFIFLFLNFYTRTYNEPKQSKTGKTATNGISSNGVNKSEKALENGKPQKNGKPKGE
Tissue specificity：Expressed in the retina, exclusively in photoreceptor cells and in the brain, skin, testis and lens. {ECO:0000269|PubMed:15028285}.
Induction：
Developmental stage：Expressed in the ocular tissues of the retina at 10.5 dpc and becomes restricted predominantly to the photoreceptor layer in the mature retina (at protein level). Expressed in the embryo at 7 dpc. {ECO:0000269|PubMed:15028285}.
Protein families：ELO family, ELOVL4 subfamily