DLX5_MOUSE P70396
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P70396
Recommended name：Homeobox protein DLX-5
EC number：
Alternative names：
Cleaved into：
GeneID：13395
Gene names (primary )：Dlx5
Gene names (synonym )：
Gene names (ORF )：
Length：289
Mass：31396
Sequence：MTGVFDRRVPSIRSGDFQAPFPTSAAMHHPSQESPTLPESSATDSDYYSPAGAAPHGYCSPTSASYGKALNPYQYQYHGVNGSAAGYPAKAYADYGYASPYHQYGGAYNRVPSATSQPEKEVAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYPSAASSINSHLPPPGSLQHPLALASGTLY
Tissue specificity：Expressed in osteoblasts and chondrocytes. {ECO:0000269|PubMed:19956613}.
Induction：Up-regulated by BMP2. {ECO:0000269|PubMed:15383550, ECO:0000269|PubMed:18056716}.
Developmental stage：Expressed in the otic vesicle, mandibular arch, branchial arches 2 and 3, in proximal anterior mesodermal domain in the limb, immature and proliferating chondroblasts at 14.5 dpc. {ECO:0000269|PubMed:19956613}.
Protein families：Distal-less homeobox family