HEYL_MOUSE Q9DBX7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DBX7
Recommended name:Hairy/enhancer-of-split related with YRPW motif-like protein
EC number:
Alternative names:(Hairy and enhancer of split-related protein 3) (Hairy-related transcription factor 3) (HRT-3) (mHRT3)
Cleaved into:
GeneID:56198
Gene names (primary ):Heyl
Gene names (synonym ):Hesr3 Hrt3
Gene names (ORF ):
Length:326
Mass:34929
Sequence:MKRPRAPSGSDGESDGPIDVGQENDLSQMARPLTTPSPSQMQARKKRRGIIEKRRRDRINSSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHASGGTGFFDARALAVDFRSIGFRECLTEVIRYLGVLEGPSSHADPVRIRLLSHLKSYAAEMEPSPTTTSALAFPVWPWSFLHSCPGLPSLNSQLAILGRVPGPVLPSISSPPYPISALRSAPVHRPAGTIPPTRRNLLPSRGVTSTQRAHLPERPAAPPPTALDARAARSIVPIPPCSPTTAPGAGKSDDNVSGSISSPCPSGPTGRPAGAVFYHSWVSEITEIGAF
Tissue specificity:Expressed in heart and at lower levels in brain, lung, muscle, ovary and testis. {ECO:0000269|PubMed:10860664}.
Induction:By activation of the Notch signaling pathway.
Developmental stage:Expressed in the presmitic mesoderm, the somites, the developing peripheral nervous system and arterial smooth muscle. Expressed in atrioventricular cushions from 9.5 dpc to 12.5 dpc. Also expressed in developing retina. {ECO:0000269|PubMed:11044625, ECO:0000269|PubMed:11160397, ECO:0000269|PubMed:17303760}.
Protein families:HEY family