FIZ1_MOUSE   Q9WTJ4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9WTJ4

Recommended name:Flt3-interacting zinc finger protein 1

EC number:

Alternative names:

Cleaved into:

GeneID:23877

Gene names  (primary ):Fiz1

Gene names  (synonym ):

Gene names  (ORF ):

Length:500

Mass:52685

Sequence:MEDSSLPVVPAPIAAPGPAPSATAPRVPFHCSECGKSFRYRSDLRRHFARHTALKPHACPRCGKGFKHSFNLANHLRSHTGERPYRCSACPKGFRDSTGLLHHQVVHTGEKPYCCLVCELRFSSRSSLGRHLKRQHRGTLPSPLQPSPGLPPLSSPCSVCCNVGPCSVCGGGGSSGGEGLEGAGATSWGLAEAAAAAAASLPPFACGACARRFDHGRELAAHWAAHTDVKPFKCPRCERDFNAPALLERHKLTHDLQGSNAPPTQVWASGGGPEVAGEGDASEVGAAPQTWDAGLLLSPTGAGVPKLEALLPGDEGSGNDQAPAAAAEASSEDTLYQCDCGTFFASAPALASHLEAHSGPATYGCGHCGALYAALAALEEHRRASHGEGSGEAAPDGEGNQAAGGPGPGSSSRSKKIFGCSECEKLFRSPRDLERHVLVHTGEKPFPCLECGKFFRHECYLKRHRLLHGTERPFPCHICGKGFITLSNLSRHLKLHRGMD

Tissue specificity:Widely expressed. In the retina, highest expression in the ganglion cell layer. {ECO:0000269|PubMed:10409713, ECO:0000269|PubMed:12566383}.

Induction:

Developmental stage:Expressed in the retina at 14.5 dpc. {ECO:0000269|PubMed:12566383}.

Protein families:


   💬 WhatsApp