BFSP2_MOUSE Q6NVD9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6NVD9
Recommended name：Phakinin
EC number：
Alternative names：(49 kDa cytoskeletal protein) (Beaded filament structural protein 2) (Lens fiber cell beaded filament protein CP 47) (CP47) (Lens fiber cell beaded filament protein CP 49) (CP49) (Lens intermediate filament-like light) (LIFL-L)
Cleaved into：
GeneID：107993
Gene names (primary )：Bfsp2
Gene names (synonym )：
Gene names (ORF )：
Length：416
Mass：45740
Sequence：MSKRRVAADLPSGTNSSMPVQRHRVSSLRGTHSPSSLDSPPASRTSAVGSLVRAPGVYVGVAPSGGIGGLGARVTRRALGISSVFLQGLRSSGLANVPAPGPERDHTTVEDLGGCLVEYMTKVHALEQVSQELETQLRAHLESKAKSSGGWDALRASWASSYQQVGEAVLENARLLLQMETIQAGADDFKERYENEQPFRKAAEEEVSSLYKVIDEANLTKTDLEHQIESLKEELGFLSRSYEEDVKVLYKQLAGSELEQADVPMGTGLDDVLETIRVQWERDVEKNRAEAGALLQAKQQTEVVHVSQTQEEKLAAALSVELHDTSRQVQSLQAETESLRALKRGLENSLHDAQHWHDMELQNLGAVVGRLEAELAEIRSETEQQQQERAHLLACKSQLQKDVASYHALLDREENN
Tissue specificity：Detected in retina lens fiber cells (at protein level) (PubMed:7679620, PubMed:12454043, PubMed:15037121, PubMed:14985306, PubMed:19029034, PubMed:21745462, PubMed:27559293). Also expressed in the lens epithelium, abundantly expressed in the anterior and anterolateral epithelium, less frequently expressed nearer the lens coronal equator (at protein level) (PubMed:27559293). {ECO:0000269|PubMed:12454043, ECO:0000269|PubMed:14985306, ECO:0000269|PubMed:15037121, ECO:0000269|PubMed:19029034, ECO:0000269|PubMed:21745462, ECO:0000269|PubMed:27559293, ECO:0000269|PubMed:7679620}.
Induction：
Developmental stage：Expressed in the retinal lens fiber cells from postnatal day 28 (P28) to P45 (PubMed:27559293). Expressed in retinal lens beaded filament structures from P37 onwards (PubMed:27559293). {ECO:0000269|PubMed:27559293}.
Protein families：Intermediate filament family