MYP0_MOUSE   P27573


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P27573

Recommended name:Myelin protein P0

EC number:

Alternative names:(Myelin peripheral protein) (MPP) (Myelin protein zero)

Cleaved into:

GeneID:17528

Gene names  (primary ):Mpz

Gene names  (synonym ):P0

Gene names  (ORF ):

Length:248

Mass:27622

Sequence:MAPGAPSSSPSPILAALLFSSLVLSPALAIVVYTDREIYGAVGSQVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGAFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGILGVVLLLLLLFYLIRYCWLRRQAALQRRLSAMEKGRFHKSSKDSSKRGRQTPVLYAMLDHSRSTKAASEKKSKGLGESRKDKK

Tissue specificity:Found only in peripheral nervous system Schwann cells.

Induction:

Developmental stage:Expressed in the sciatic nerves at postnatal days P6 to P12. {ECO:0000269|PubMed:10068633}.

Protein families:Myelin P0 protein family


   💬 WhatsApp