VGLL2_MOUSE Q8BGW8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BGW8
Recommended name：Transcription cofactor vestigial-like protein 2
EC number：
Alternative names：(Vgl-2) (Protein VITO1)
Cleaved into：
GeneID：215031
Gene names (primary )：Vgll2
Gene names (synonym )：Vgl2 Vito1
Gene names (ORF )：
Length：322
Mass：34064
Sequence：MSCLDVMYQVYGPPQPYFAAAYTPYHQKLAYYSKMQEAQECASPGSSASGSSSFSNPTPASVKEEEGSPEKERPPEAEYINSRCVLFTYFQGDISSVVDEHFSRALSHPSSYTPSCTSSKAHRSSGPWRAEGTFPMSQRSFPASFWNSAYQAPVPAPLGSPLAAAHSELPFATDPYSPATLHGHLHQGAADWHHAHPHHAHPHHPYALGGALGAQASAYPRPAVHEVYAPHFDPRYGPLLMPAATGRPGRLAPASAPAPGSPPCELAAKGEPAGSAWAAPGGPFVSPTGDVAQSLGLSVDSGKRRRECSLPSAPPALYPTLG
Tissue specificity：Skeletal muscle specific. {ECO:0000269|PubMed:12617818}.
Induction：
Developmental stage：Expressed in the somitic myotome from 8.75 dpc mouse embryos onwards and later on in skeletal muscle but not in the heart. Additional expression domains during development are detected in the pharyngeal pouches and clefts starting at 8.0 dpc as well as in the cranial pharynx and in Rathkes pouch. {ECO:0000269|PubMed:12617818}.
Protein families：Vestigial family