PO4F1_MOUSE   P17208


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P17208

Recommended name:POU domain, class 4, transcription factor 1

EC number:

Alternative names:(Brain-specific homeobox/POU domain protein 3A) (Brain-3A) (Brn-3A) (Brn-3.0)

Cleaved into:

GeneID:18996

Gene names  (primary ):Pou4f1

Gene names  (synonym ):Brn-3 Brn3 Brn3a

Gene names  (ORF ):

Length:421

Mass:42767

Sequence:MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAVDIAVSQGKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHISSPSLALMAGAGGAGAAGGGGGAHDGPGGGGGPGGGGGPGGGGPGGGGGGGGPGGGGGGPGGGLLGGSAHPHPHMHGLGHLSHPAAAAAMNMPSGLPHPGLVAAAAHHGAAAAAAAAAAGQVAAASAAAAVVGAAGLASICDSDTDPRELEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELFNGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY

Tissue specificity:Expressed in mature osteoclasts (at protein level) (PubMed:17668438). Brain, peripheral sensory nervous system and retina (PubMed:8162704). In the adult nervous system, predominates in the medial habenula, superficial gray of the superior colliculus, red nucleus, mesencephalic nucleus of the trigeminal ganglion, nucleus ambiguus, inferior olivary nucleus, and peripheral sensory ganglia (PubMed:8290353). {ECO:0000269|PubMed:17668438, ECO:0000269|PubMed:8162704, ECO:0000269|PubMed:8290353}.

Induction:Up-regulated by the osteoclast differentiation factor TNFSF11 (PubMed:17668438). {ECO:0000269|PubMed:17668438}.

Developmental stage:Expressed in the spinal cord from 11 dpc to the adult stage (PubMed:8290353). As early as 10.5 dpc to 15.5 dpc, strongly expressed in all dorsal root ganglion neurons (PubMed:22326227). In retinal ganglion cells, expression starts at 15.5 dpc and exhibits a slow decrease with moderate levels detectable at P8 (PubMed:8637595). {ECO:0000269|PubMed:22326227, ECO:0000269|PubMed:8290353, ECO:0000269|PubMed:8637595}.

Protein families:POU transcription factor family, Class-4 subfamily


   💬 WhatsApp