PAQRA_MOUSE   Q8R189


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R189

Recommended name:Monocyte to macrophage differentiation factor 2

EC number:

Alternative names:(Progestin and adipoQ receptor family member 10) (Progestin and adipoQ receptor family member X)

Cleaved into:

GeneID:75104

Gene names  (primary ):Mmd2

Gene names  (synonym ):Paqr10

Gene names  (ORF ):

Length:247

Mass:28910

Sequence:MFTLARLLDFQKTKYARFMNDRVPAHKRYQPTEYEHAANCATHAFWIIPSILGSSNLYFLSDDDWETISAWIYGLGLCGLFVVSTIFHTVSWKKSHLRMVEHCLHMIDRMVIYFFIAASYAPWLNLRELGPWASHMRWLVWIMASIGTIYVFFFHERYKLVELLCYVVMGFFPALVILSMPNTDGIWELMTGGAFYCLGMVFFKSDGRIPFAHAIWHLFVAFGAGTHYYAIWRYLYLPSTLQTKVSK

Tissue specificity:

Induction:

Developmental stage:Expressed in the testicular cords at 13.5 dpc. {ECO:0000269|PubMed:12617826}.

Protein families:ADIPOR family


   💬 WhatsApp