RALY_MOUSE Q64012
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64012
Recommended name：RNA-binding protein Raly
EC number：
Alternative names：(Maternally-expressed hnRNP C-related protein) (hnRNP associated with lethal yellow protein)
Cleaved into：
GeneID：19383
Gene names (primary )：Raly
Gene names (synonym )：Merc
Gene names (ORF )：
Length：312
Mass：33188
Sequence：MSLKIQTSNVTNKNDPKSINSRVFIGNLNTAVVKKSDVETIFSKYGRVAGCSVHKGYAFVQYANERHARAAVLGENGRVLAGQTLDINMAGEPKPNRPKGLKRAATAIYSGYSFDYDYYQDYFCARLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTTIPVKLFARSTAVTTGSAKIKLKSSELQTIKTELTQIKSNIDALLGRLEQIAEEQKANPDGKKKGDSSSGGGGGSSGGGGSSNVGGGSSGGSGSCSSSSRLPAPQEDTASEAGTPQGEVQTRDDGDEEGLLTHSEEELEHSQDTDAEDGALQ
Tissue specificity：Widely expressed. Expressed in brain, testis, lung, spleen and kidney. Weakly expressed in liver. {ECO:0000269|PubMed:8319910}.
Induction：
Developmental stage：Expressed in the unfertilized egg, in the blastocyst, as well as in the developing embryo and fetus. Expressed in developing skin. {ECO:0000269|PubMed:8319910}.
Protein families：RRM HNRPC family, RALY subfamily