LIMK1_MOUSE   P53668


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P53668

Recommended name:LIM domain kinase 1

EC number:EC 2.7.11.1

Alternative names:(LIMK-1) (KIZ-1)

Cleaved into:

GeneID:16885

Gene names  (primary ):Limk1

Gene names  (synonym ):Limk

Gene names  (ORF ):

Length:647

Mass:72793

Sequence:MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCECSVSLSHQYYEKDGQLFCKKDYWARYGESCHGCSEHITKGLVMVAGELKYHPECFICLACGNFIGDGDTYTLVEHSKLYCGQCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASAHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPHDSLGHGPVSDPSPLSSPVHTPSGQAASSARQKPVLRSCSIDTSPGTSSLASPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKNMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENRNVVVADFGLARLMIDEKNQSEDLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEQWLETLRMHLSGHLPLGPQLEQLERGFWETYRRGESSLPAHPEVPD

Tissue specificity:Highest expression in the nervous system, particularly in the spinal cord and the cranial nerve and dorsal root ganglia.

Induction:

Developmental stage:Expressed in ventral neural tube and axonal projections at 12.5 dpc-13 dpc (at protein level). {ECO:0000269|PubMed:16204183}.

Protein families:Protein kinase superfamily, TKL Ser/Thr protein kinase family


   💬 WhatsApp