ZAR1_MOUSE Q80SU3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80SU3
Recommended name：Zygote arrest protein 1
EC number：
Alternative names：(Oocyte-specific maternal effect factor)
Cleaved into：
GeneID：317755
Gene names (primary )：Zar1
Gene names (synonym )：
Gene names (ORF )：
Length：361
Mass：39986
Sequence：MFPASTFHPCPHPYPQATKAGDGWRFGARGCRPAPPSFLPGYRQLMAAEYVDSHQRAQLMALLSRMGPRSVSSRDAAVQVNPRRDASVQCSLGRRTLQPAGCRASPDARSGSCQPRGHAGAGRSPRSWQTVAPFSSVTFCGLSSSLEVAGGRQTPTKGEGSPASSGTREPEPREVAARKAVPQPRSEEGDVQAAGQAGWEQQPPPEDRNSVAAMQSEPGSEEPCPAAEMAQDPGDSDAPRDQASPQSTEQDKERLRFQFLEQKYGYYHCKDCKIRWESAYVWCVQGTSKVYFKQFCRVCEKSYNPYRVEDITCQSCKRTRCACPVRLRHVDPKRPHRQDLCGRCKDKRLSCDSTFSFKYII
Tissue specificity：Ovary. Expressed in primary oocytes (from primary through antral follicle stages) and during the progression from Meiosis I to Meiosis II. The mRNA is detected in growing oocytes (early primary follicle, type 3a) through fully grown oocytes (antral follicle, type 8). {ECO:0000269|PubMed:12539046, ECO:0000269|PubMed:12773403}.
Induction：
Developmental stage：Expressed in zygote at the one-cell embryo, markedly less abundant at the two-cell embryo. {ECO:0000269|PubMed:12539046}.
Protein families：ZAR1 family