XBP1_MOUSE O35426
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35426
Recommended name：X-box-binding protein 1
EC number：
Alternative names：(XBP-1) (Tax-responsive element-binding protein 5) (TREB-5)
Cleaved into：X-box-binding protein 1, cytoplasmic form; X-box-binding protein 1, luminal form
GeneID：22433
Gene names (primary )：Xbp1
Gene names (synonym )：Treb5
Gene names (ORF )：
Length：267
Mass：29619
Sequence：MVVVAAAPSAATAAPKVLLLSGQPASGGRALPLMVPGPRAAGSEASGTPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENHKLQLENQLLREKTHGLVVENQELRTRLGMDTLDPDEVPEVEAKGSGVRLVAGSAESAALRLCAPLQQVQAQLSPPQNIFPWTLTLLPLQILSLISFWAFWTSWTLSCFSNVLPQSLLVWRNSQRSTQKDLVPYQPPFLCQWGPHQPSWKPLMNSFVLTMYTPSL
Tissue specificity：Isoform 1 and isoform 2 are expressed at higher level in branch curves of vessel walls and in atherosclerotic plaques relative to healthy segments of the same aortas (at protein level) (PubMed:19416856). Expressed in skeletal muscles, plasma cells and pancreatic beta cells (PubMed:17612490). Isoform 1 and isoform 2 are expressed in gonadal adipose tissue. Isoform 1 is expressed in inguinal adipose tissue (PubMed:23623498). {ECO:0000269|PubMed:17612490, ECO:0000269|PubMed:19416856, ECO:0000269|PubMed:23623498}.
Induction：Isoform 2 is up-regulated during adipocyte differentiation (PubMed:25223794). Isoform 2 is up-regulated upon refeeding after a fasting period in liver and in ob/ob mice (obese) (at protein level) (PubMed:20348926). Induced by chemical activators of the unfolded protein response (UPR) such as tunicamycin, DTT and thapsigargin (PubMed:17612490). Up-regulated after partial hepatectomy during the acute phase response (PubMed:10652269). Isoform 1 and isoform 2 are up-regulated by interleukin-4 in B cells in a STAT6-dependent manner (PubMed:12612580). Isoform 1 and isoform 2 are up-regulated during lactation and by the lactogenic hormone prolactin (PubMed:23623498). Isoform 2 is up-regulated by prolonged feeding of high-carbohydrate diets in hepatocytes in absence of ER-stress (PubMed:18556558). Isoform 2 is up-regulated by insulin-like growth factor and glucose starvation (PubMed:17612490). Isoform 2 is up-regulated during plasma-cell differentiation in response to endoplasmic reticulum (ER) stress, such as lipopolysaccharide (LPS) (PubMed:11780124, PubMed:11850408, PubMed:12612580). {ECO:0000269|PubMed:10652269, ECO:0000269|PubMed:11780124, ECO:0000269|PubMed:11850408, ECO:0000269|PubMed:12612580, ECO:0000269|PubMed:17612490, ECO:0000269|PubMed:18556558, ECO:0000269|PubMed:20348926, ECO:0000269|PubMed:23623498, ECO:0000269|PubMed:25223794}.
Developmental stage：Expressed mainly in exocrine glands and bone precursors in the embryonic mouse (PubMed:7693055). {ECO:0000269|PubMed:7693055}.
Protein families：BZIP family