NREP_MOUSE Q07475
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q07475
Recommended name:Neuronal regeneration-related protein
EC number:
Alternative names:(Neuronal protein 3.1) (Protein p311)
Cleaved into:
GeneID:27528
Gene names (primary ):Nrep
Gene names (synonym ):D0H4S114 P311
Gene names (ORF ):
Length:68
Mass:7688
Sequence:MVYYPELLVWVSQEPFAYKEMEGGLIKGRLPVPKEVNRKKMEETGAASLTPPGSREFTSPATSYLHPF
Tissue specificity:Expressed in brain and fetal lung. {ECO:0000269|PubMed:16484684, ECO:0000269|PubMed:8261136}.
Induction:Down-regulated in lungs by dexamethasone treatment. {ECO:0000269|PubMed:16484684}.
Developmental stage:Expressed mainly in neurons belonging to a late migration wave. During adulthood, it persists at a high level in the granular layer of the cerebellum, the hippocampus and the olfactory bulb. In lung, detected at low levels at the pseudoglandular stage (14.5 dpc), with expression starting to increase at the beginning of distal lung development (16.5 dpc) and remaining at the same level during saccular development (18.5 dpc). The expression levels are highest at the beginning of and during alveolar development (P5-P14) before decreasing again to low levels at the end of alveolization (P30). {ECO:0000269|PubMed:16484684, ECO:0000269|PubMed:8261136}.
Protein families: