HSPB9_MOUSE Q9DAM3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DAM3
Recommended name：Heat shock protein beta-9
EC number：
Alternative names：(HspB9)
Cleaved into：
GeneID：75482
Gene names (primary )：Hspb9
Gene names (synonym )：
Gene names (ORF )：
Length：168
Mass：18493
Sequence：MQRVGSSFSTGQREPGENRVASRCPSVALAERNQVATLPVRLLRDEVQGNGCEQPSFQIKVDAQGFAPEDLVVRIDGQNLTVTGQRQHESNDPSRGRYRMEQSVHRQMQLPPTLDPAAMTCSLTPSGHLWLRGQNKCLPPPEAQTGQSQKPRRGGPKSSLQNESVKNP
Tissue specificity：Testis specific. {ECO:0000269|PubMed:11470154}.
Induction：
Developmental stage：Expressed notably in the spermatogenic cells from late pachytene spermatocyte stage till elongate spermatid stage. {ECO:0000269|PubMed:11470154}.
Protein families：Small heat shock protein (HSP20) family