CST13_MOUSE Q80ZN5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80ZN5
Recommended name：Cystatin-13
EC number：
Alternative names：(Cystatin-T)
Cleaved into：
GeneID：69294
Gene names (primary )：Cst13
Gene names (synonym )：Cymg1
Gene names (ORF )：
Length：141
Mass：16825
Sequence：MARFLQTLLFLVIMVEFVSRRVEAWGSPQIVRPFEDIPKSYVYVQHALWYAMKEYNKASNDLYNFRVVDILKSQEQITDSLEYYLEVNIARTMCKKIAGDNENCLFQQDPKMKKMVFCIFIVSSKPWKFELKMLKKQCKDI
Tissue specificity：Expressed exclusively in testis. Found in spermatagonia, spermatocytes, round spermatids, elongating spermatids and spermatozoa. {ECO:0000269|PubMed:15645076}.
Induction：
Developmental stage：Expressed only in the adult. Levels are low 1 week postpartum, steadily increase 2 to 5 weeks postpartum, are highest at 7 weeks and then drop to back the levels found at 5 weeks. {ECO:0000269|PubMed:15645076}.
Protein families：Cystatin family