H2AB1_MOUSE Q9CQ70
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CQ70
Recommended name：Histone H2A-Bbd type 1
EC number：
Alternative names：(H2A Barr body-deficient) (H2A.Bbd) (Histone H2A-like 2) (H2A.L.2) (H2AL2) (Histone H2Alike 2) (Testis-specific expressed gene 1 protein) (TSEG-1)
Cleaved into：
GeneID：68231
Gene names (primary )：H2ab1
Gene names (synonym )：H2afb1 H2al2a
Gene names (ORF )：
Length：111
Mass：12843
Sequence：MARKRQRRRRRKVTRSQRAELQFPVSRVDRFLREGNYSRRLSSSAPVFLAGVLEYLTSNILELAGEVAHTTGRKRIAPEHVCRVVQNNEQLHQLFKQGGTSVFEPPEPDDN
Tissue specificity：Highly expressed in adult testis, mainly in spermatocytes (PubMed:20008104, PubMed:20188161, PubMed:17261847). {ECO:0000269|PubMed:17261847, ECO:0000269|PubMed:20008104, ECO:0000269|PubMed:20188161}.
Induction：
Developmental stage：Expressed since postnatal day (P) 21, peaks at P30, and gradually decreases in the testis of aging mouse (PubMed:20008104, PubMed:20188161). Coexpressed with transition proteins during late spermiogenesis (PubMed:28366643). Strongly enriched in step 12-16 spermatids and accumulate during late spermiogenesis, in condensing spermatids (PubMed:17261847). Remains present in mature spermatozoa isolated from epididymis (PubMed:17261847). Rapidly disappears from the paternal pericentric heterochromatin regions after sperm-egg fusion (PubMed:18703863). {ECO:0000269|PubMed:17261847, ECO:0000269|PubMed:18703863, ECO:0000269|PubMed:20008104, ECO:0000269|PubMed:20188161, ECO:0000269|PubMed:28366643}.
Protein families：Histone H2A family