CBY2_MOUSE Q32MG2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q32MG2
Recommended name：Protein chibby homolog 2
EC number：
Alternative names：(Protein nurit) (Spermatid-associated protein)
Cleaved into：
GeneID：67926
Gene names (primary )：Cby2
Gene names (synonym )：Nurit Spert
Gene names (ORF )：
Length：446
Mass：51865
Sequence：MSPLECSECFGDQLLHKTYTWHLTLHSRPNFTRKRDTRSESLEIPVNVILPQRGTEPFLRLHNLYSTPRCSRQAALPRMSRRVASQHSYPLNRFSSMPFDPMERPTSQADLELDYNPPRVQLSDEMFVFQDGRWVNESCRLQPPYFSPPSSFHHKLHHRRLAKEYQLQEENKSLRDENRALRDENKALRKENKILQVFWEEHKVTLGHEESQTSSLLHKDTTSQEVVKRDNTTLPAQRSKESTLQLIREENRALQQLLEQRQAYWAQAEENAASTEEGKSTSSPKEESHNSGLLPDQSTNHSSPFEDPKVPPTTQEDSKTLRALREMVNNLSGASGEEDGKVGPNLPDSAQPLQLLREMNQALQALQEENRLLQEENRALHILREEHRVFQEENKALWENNKLKLQQRLVIDTVTEVTARMEMLIEELYAFMPAKNNKDPKKPSRV
Tissue specificity：Expression is restricted to the flower-like structure in spermatids. {ECO:0000269|PubMed:12204287}.
Induction：
Developmental stage：Expressed through the elongation stage of the spermatids but absent from mature spermatozoa. {ECO:0000269|PubMed:12204287}.
Protein families：Chibby family, SPERT subfamily