EFHD2_MOUSE Q9D8Y0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D8Y0
Recommended name：EF-hand domain-containing protein D2
EC number：
Alternative names：(Swiprosin-1)
Cleaved into：
GeneID：
Gene names (primary )：Efhd2
Gene names (synonym )：Sws1
Gene names (ORF )：
Length：240
Mass：26791
Sequence：MATDELASKLSRRLQMEGEGGEATEQPGLNGAAAAAAAEAPDETAQALGSADDELSAKLLRRADLNQGIGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIQEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLQVLARLSEIDVSTEGVKGAKNFFEAKVQAINVSSRFEEEIKAEQEERKKQAEEVKQRKAAFKELQSTFK
Tissue specificity：Detected in thymus, kidney, spleen, lung, liver and brain. Highest abundance in brain and lowest in kidney and thymus. {ECO:0000269|PubMed:17673920}.
Induction：
Developmental stage：Expressed throughout B-cell differentiation, with highest expression in immature bone marrow B-cells. {ECO:0000269|PubMed:17673920}.
Protein families：