TRIP6_MOUSE Q9Z1Y4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z1Y4
Recommended name：Thyroid receptor-interacting protein 6
EC number：
Alternative names：(TR-interacting protein 6) (TRIP-6) (Zyxin-related protein 1) (ZRP-1)
Cleaved into：
GeneID：22051
Gene names (primary )：Trip6
Gene names (synonym )：Zrp1
Gene names (ORF )：
Length：480
Mass：50934
Sequence：MSGPTWLPPKQPEPSRLPQGRSLPRGALGPPTAHGATLQPHPRVNFCPLPPEHCYQPPGVPEDRGPTWVGSHGTPQRLQGLPPDRGIIRPGSLDAEIDSLTSMLADLDGGRSHAPRRPDRQAFEAPPPHAYRGGSLKPSGGAVPTPMLPASHYGGPTPASYATASTPAGPAFPVQVKVAQPVRGCGLPRRGASQASGPLPGPHFPLTGRGEVWGAGYRSHREPGPGVPEGPSGVHIPAGGGRGGGHEPQGPLGQPPEEELERLTKKLVHDMSHPPSGEYFGRCGGCGEDVVGDGAGVVALDRVFHIGCFVCSTCRAQLRGQHFYAVERRAYCESCYVATLEKCSTCSEPILDRILRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVALDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC
Tissue specificity：Highly expressed in kidney, stomach, lung, heart and testis. Low expression levels in brain, colon, thymus, pancreas and skin. Not expressed in skeletal muscle. {ECO:0000269|PubMed:10826496}.
Induction：
Developmental stage：Expressed throughout development in all embryonic stages analyzed, 10.5 days post coitum (dpc) to 18.5 dpc. In 16.5 dpc embryos highly expressed in skin, lung, thymus, duodenum and the ependymal cell layer surrounding the ventricles in brain. Highly expressed also in the salivary glands, tongue, vibrissae, choroid plexus, blood vessel walls, esophagus and midgut. Low expression levels in spinal cord, heart and liver. {ECO:0000269|PubMed:10826496}.
Protein families：Zyxin/ajuba family