PKDCC_MOUSE Q5RJI4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5RJI4
Recommended name:Extracellular tyrosine-protein kinase PKDCC
EC number:EC 2.7.10.2
Alternative names:(Protein kinase domain-containing protein, cytoplasmic) (Protein kinase-like protein SgK493) (Sugen kinase 493) (Vertebrate lonesome kinase)
Cleaved into:
GeneID:106522
Gene names (primary ):Pkdcc
Gene names (synonym ):Sgk493 Vlk
Gene names (ORF ):
Length:492
Mass:53841
Sequence:MRRRRAAVAAGFCASFLLGSVLNVLFAPGSEPPRPGQSPGSSAAPGPGRRGGRGELARQIRERYEEVQRYSRGGPGPGAGRPERRRLMDLAPGGPGLQRPRPPRVRSPPDGAPGWPPAPGPGSPGPGPRLGCAALRNVSGAQYVGSGYTKAVYRVRLPGGAAVALKAVDFSGHDLGSCVREFGARRGCYRLAAHKLLKEMVLLERLRHPNVLQLYGYCYQDSEGIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVNGELKVTDLDDARVEETPCTSSADCTLEFPARNFSLPCSAQGWCEGMNEKRNLYNAYRFFFTYLLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLETALHLFRSGQYLQNSTSSRAEYQRIPDSAITQEDYRCWPSYHHGGCLLSVFNLAEAIDVCESHAQCRAFVVTNQTTWTGRKLVFFKTGWNQVVPDAGKTTYVKAPG
Tissue specificity:Strongly expressed in adult heart, liver and testis with weak expression in brain, spleen, lung and thymus. In the humerus, strongly expressed in early flat proliferative chondrocytes. In the embryo, expressed in the anterior visceral endoderm and anterior primitive streak at 6.5 dpc. At 7.5 dpc, expressed in the anterior definitive endoderm (ADE) and anterior mesoderm but not in the notochord. At 8.0 dpc, expressed in the ADE and anterior embryonic mesoderm. At 8.5 dpc, expressed more broadly in anterior tissues and at the midline of the neural plate in the midbrain region as well as the lateral margins of the neural plate posterior to the metencephalic region. Also weakly expressed in the anterior mesenchyme. At 9.5 dpc, strongest expression in branchial arches and limb buds. During mid-gestation, expression continues in mesenchymal cells, particularly in areas where these cells condense. {ECO:0000269|PubMed:19097194, ECO:0000269|PubMed:19465597}.
Induction:Down-regulated by hedgehog (Hh) signaling. {ECO:0000269|PubMed:23792766}.
Developmental stage:Expressed throughout embryogenesis and in adulthood. During embryogenesis, expression is high at transition phases of mesenchymal cell differentiation such as from mesenchymal cells to chondrocytes and from mesenchymal to mesothelial cells. Expressed throughout all stages of humerus bone formation. During lung development, expressed in all mesenchymal cells at the early pseudoglandular stage. Expression is rapidly lost from the mesenchyme of the lung interstitium during the mid-to-late pseudoglandular stage but continues throughout life in the mesothelial pleural cells. {ECO:0000269|PubMed:19097194, ECO:0000269|PubMed:19465597}.
Protein families:Protein kinase superfamily