ING1_MOUSE Q9QXV3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QXV3
Recommended name：Inhibitor of growth protein 1
EC number：
Alternative names：
Cleaved into：
GeneID：26356
Gene names (primary )：Ing1
Gene names (synonym )：
Gene names (ORF )：
Length：279
Mass：32109
Sequence：MLSPANGEQIHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDDYYEKFKRETDGTQKRRVLHCIQRALIRSQELGDEKIQIVSQMVELVENRSRQVDSHVELFEAHQDISDGTGGSGKAGQDKSKSEAITQADKPNNKRSRRQRNNENRENASNNHDHDDITSGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGESEKTMDKALEKSKKERAYNR
Tissue specificity：In the adult, widely expressed with highest levels in thymus and testis. {ECO:0000269|PubMed:10542254}.
Induction：
Developmental stage：Expressed throughout the whole embryo at all stages of development examined. At day 10, highest expression is found in the yolk sac while at day 16 and 18, higher levels are found in inner compartments of bone. In the embryo, highest expression of isoform 1 is found at day 11 while highest expression of isoform 2 is found at day 7. {ECO:0000269|PubMed:10542254}.
Protein families：ING family