FHL3_MOUSE Q9R059
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R059
Recommended name：Four and a half LIM domains protein 3
EC number：
Alternative names：(FHL-3) (Skeletal muscle LIM-protein 2) (SLIM-2)
Cleaved into：
GeneID：14201
Gene names (primary )：Fhl3
Gene names (synonym )：
Gene names (ORF )：
Length：289
Mass：31795
Sequence：MSEAFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNECYCTAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCKTPLAGQQFTSRDDDPYCVACFGELFAPKCSSCKRPITGGSGGGEGAGLGGGKYVSFEDRHWHHSCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP
Tissue specificity：Expressed in myogenic progenitor cells (at protein level) (PubMed:17363903). Expressed in skeletal striated muscle and the heart (PubMed:10906474, PubMed:17363903). Expressed to a lesser extent, in lung, and kidney (PubMed:10906474). Expressed in skin and skeletal muscles such as the masseter, tongue, tibialis anterior and plantar muscles (PubMed:10049693). {ECO:0000269|PubMed:10049693, ECO:0000269|PubMed:10906474, ECO:0000269|PubMed:17363903}.
Induction：
Developmental stage：Expressed ubiquitously at low levels during embryonic development. {ECO:0000269|PubMed:10906474}.
Protein families：