RIT2_MOUSE P70425
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P70425
Recommended name：GTP-binding protein Rit2
EC number：EC 3.6.5.2
Alternative names：(Ras-like protein expressed in neurons) (Ras-like without CAAX protein 2)
Cleaved into：
GeneID：19762
Gene names (primary )：Rit2
Gene names (synonym )：Rin Roc2
Gene names (ORF )：
Length：217
Mass：24802
Sequence：MEVENEAHCCPGSSSGGSREYKVVMLGAGGVGKSAVTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGMNLARDYNCAFFETSAALRFGIDDAFQGLVREIRRKESMLSLVERKLKRKDSLWKKIKASLKKKRENML
Tissue specificity：Expressed in ganglion cell layer (GCL), inner plexiform layer (IPL) and inner nuclear layer (INL) of the retina. Expressed in retinal ganglion cells (RGCs). Expressed in horizontal, bipolar and amacrine cells, but not Mueller glia, of the INL (at protein level). Neuron-specific (PubMed:8824319). Expressed in ganglion cell layer (GCL) and inner plexiform layer (IPL) (PubMed:23805044). {ECO:0000269|PubMed:23805044, ECO:0000269|PubMed:8824319}.
Induction：
Developmental stage：Expressed weakly in ganglion cell layer (GCL) and inner neuroblastic layer (NBL) of the embryonic retina at 15.5 dpc. Expression increases progressively in the retina from new borns at postnatal day 2 (P2), P5, P15 to 8 week-old adult (at protein level). {ECO:0000269|PubMed:23805044}.
Protein families：Small GTPase superfamily, Ras family