TNMD_MOUSE Q9EP64
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9EP64
Recommended name：Tenomodulin
EC number：
Alternative names：(TeM) (mTeM) (Chondromodulin-1-like protein) (ChM1L) (mChM1L) (Chondromodulin-I-like protein) (Myodulin) (Tendin)
Cleaved into：
GeneID：64103
Gene names (primary )：Tnmd
Gene names (synonym )：Chm1l
Gene names (ORF )：
Length：317
Mass：37047
Sequence：MAKNPPENCEGCHILNAEALKSKKICKSLKICGLVFGILALTLIVLFWGSKHFWPEVSKKTYDMEHTFYSNGEKKKIYMEIDPITRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLIAVSELQDFEEDGEDLHFPTSEKKGIDQNEQWVVPQVKVEKTRHTRQASEEDLPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRVIMPCNWWVARMLGRV
Tissue specificity：Widely expressed with highest expression in tendons and ligaments, in the diaphragm, eye and skeletal muscle. Expressed in neuronal cells of all brain regions. Very low expression, if any, in glial cells. {ECO:0000269|PubMed:11357195}.
Induction：
Developmental stage：Expression already detected at 9.5 dpc and maintained throughout embryonic development. At 17.5 dpc, high levels found in tendons and ligaments of the skeletomuscular system, including the knee joint, the upper limb and the intercostal ligaments. At this developmental stage, high expression is also detected in the tendinous part of the diaphragm. By contrast, low levels are observed in resting and proliferative chondrocytes of long bones and vertebral bodies, and in the cartilaginous part of the intervertebral disks. No expression in hypertrophic chondrocytes. Outside the skeletomuscular system, expressed in neuronal cells of all brain regions and the spinal cord, liver, lung, bowels, thymus and eye. {ECO:0000269|PubMed:11357195}.
Protein families：Chondromodulin-1 family