HPLN4_MOUSE Q80WM4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80WM4
Recommended name：Hyaluronan and proteoglycan link protein 4
EC number：
Alternative names：(Brain link protein 2)
Cleaved into：
GeneID：330790
Gene names (primary )：Hapln4
Gene names (synonym )：Bral2 Lpr4
Gene names (ORF )：
Length：400
Mass：42809
Sequence：MACAPGALGHRALWAVAWGLLLLVPVLAGAQRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFADVFVALGPQHRAFGPYRGRAELQNDGPGDASLVLRNVTLQDYGRYECEVTNELEDDVGMVKLDLEGVVFPYHPRGGRYKMTFVEAQRACAEQDGILASAEQLHAAWRDGLDWCNAGWLRDGSVQYPVSHAREPCGGTGSTGAGGGTNGGVRNYGYRHNAEERYDAFCFTSNLPGRVFFLKPLRPVALAGAVRACAARGATVAKVGQLFAAWKLQLLDRCTAGWLADGSARYPIVNPRTRCGGPRPGVRSLGFPDASRRLFGVYCYRAPGAPDPAPGGWGWGWAGGGGWAGGSRDPAAWTPLRV
Tissue specificity：Expressed predominantly in brain where it is found mainly throughout the midbrain and hindbrain in a perineuronal net pattern. {ECO:0000269|PubMed:14550776}.
Induction：
Developmental stage：Expression begins at embryonic day 20 and increases thereafter. Expression continues into adulthood. {ECO:0000269|PubMed:14550776}.
Protein families：HAPLN family