FKBP7_MOUSE   O54998


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O54998

Recommended name:Peptidyl-prolyl cis-trans isomerase FKBP7

EC number:EC 5.2.1.8

Alternative names:(PPIase FKBP7) (23 kDa FK506-binding protein) (23 kDa FKBP) (FKBP-23) (FK506-binding protein 7) (FKBP-7) (Rotamase)

Cleaved into:

GeneID:14231

Gene names  (primary ):Fkbp7

Gene names  (synonym ):Fkbp23

Gene names  (ORF ):

Length:218

Mass:24913

Sequence:MNLLFRLAVFLSLWCCSDAQGQTKEESTEEVKIEVLHRPENCSKTSRKGDLLNAHYDGYLAKDGSKFYCSRTQDEGHPKWFVLGVGHVIKGLDIAMMDMCPGEKRKVIIPPSFAYGKEGYAEGKIPPNATLMFEIELYAVTKGPRSIETFKQIDTDNDRQLSKAEIELYLQKDFEKDANPRDKSYQKAVLEDIFKKNDHNGDGFISPKEYNVHQHDEL

Tissue specificity:Expressed at highest levels in heart, lung and testis. Weakly expressed in kidney and lymph node. Little or no expression detected in brain, thymus, spleen and liver. {ECO:0000269|PubMed:9806833}.

Induction:

Developmental stage:Expression begins at embryonic day 8.5. {ECO:0000269|PubMed:9806833}.

Protein families:


   💬 WhatsApp