RN133_MOUSE Q14B02
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q14B02
Recommended name：E3 ubiquitin-protein ligase RNF133
EC number：EC 2.3.2.27
Alternative names：(Goliath-related E3 ubiquitin-protein ligase 2) (RING finger protein 133) (RING-type E3 ubiquitin transferase RNF133)
Cleaved into：
GeneID：386611
Gene names (primary )：Rnf133
Gene names (synonym )：Greul2
Gene names (ORF )：
Length：382
Mass：43102
Sequence：MNPLQTSTWQNQAPSFWLLRFSFIWLVSQKCCTASAVWTAYMNISFHVGNRMLSELGETGVFGRSSILKRVAGVVVPPEGKIQNACDPNTTFILPRNKEPWIALIERGGCAFTQKIKVASEHGARGVIIYNFPGTGNQVFPMSHQAFEDIVVVMIGNIKGMEILHLIRKGVHVTVMVEVGRKHVIWLNHYFVSFMIVTTATLAYFTFYHIRRLWVARIENRRWKRLTRELKKAFGQLQVRVLKEGDEEVNPNADSCVICFEAYKPNEIVRILTCKHFFHKNCIDPWILAHGTCPMCKCDILKALGIQMDIEDGTDSLQVLMSNELPGTLSPVEEETNYELPPARTSSKVTHVQEHPTSSANAGSQPPEAEETSHPSHGQQVL
Tissue specificity：Testis-specific. {ECO:0000269|PubMed:18574499}.
Induction：
Developmental stage：Expression begins in the testis at day 21 and increases dramatically from day 28 and thereafter. {ECO:0000269|PubMed:18574499}.
Protein families：