ACL6B_MOUSE Q99MR0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99MR0
Recommended name：Actin-like protein 6B
EC number：
Alternative names：(53 kDa BRG1-associated factor B) (Actin-related protein Baf53b) (ArpN-alpha) (ArpNa) (BRG1-associated factor 53B) (BAF53B)
Cleaved into：
GeneID：83766
Gene names (primary )：Actl6b
Gene names (synonym )：Actl6 Arpna Baf53b
Gene names (ORF )：
Length：426
Mass：46891
Sequence：MSGGVYGGDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGEKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNIPAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFISMQCRELFQEMAIDIIPPYMIAAKEPVREGAPPNWKKKEKLPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERLRIPEGLFDPSNVKGLSGNTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKCP
Tissue specificity：Restricted to the brain and peripheral nervous tissue (at protein level). Present in virtually all neurons in the cerebral neocortex (layers II-VI), hippocampus (CA1-CA3 region and dentate gyrus), cerebellum (molecular, granular and Purkinje cell layers), spinal cord (dorsally and ventrally), dorsal root ganglion, retina and the olfactory bulb (mitral and granule cell layers). Expressed specifically in postmitotic neurons (at protein level). {ECO:0000269|PubMed:12368262, ECO:0000269|PubMed:12437990, ECO:0000269|PubMed:17640523}.
Induction：By retinoic acid of P19 embryonic carcinoma stem cells induced by this treatment to differentiate into neuronal cells. {ECO:0000269|PubMed:12437990}.
Developmental stage：Expression begins near the time of neuronal cell type specification. First apparent at 10.5 dpc in the nervous system, with high levels in the telencephalon and less in the diencephalon, mesencephalon and spinal cord. This pattern of expression persists and becomes more defined at 12.5 dpc and later stages. Detected in dorsal root ganglia, but not in neural crest derivatives that give rise to non-neuronal tissues, including great vessels. Expressed in postmitotic cells in the CNS, but not in actively proliferating precursor cells. At protein level, first detected at 12.5 dpc in nervous tissues. In the developing forebrain, cerebellar primordium and spinal cord, strictly expressed in postmitotic neurons. {ECO:0000269|PubMed:12368262, ECO:0000269|PubMed:17640523}.
Protein families：Actin family