3BHS4_MOUSE Q61767
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61767
Recommended name：NADPH-dependent 3-keto-steroid reductase Hsd3b4
EC number：EC 1.1.1.270
Alternative names：(3 beta-hydroxysteroid dehydrogenase type 4) (3 beta-hydroxysteroid dehydrogenase type IV) (3 beta-HSD IV) (Dihydrotestosterone 3-ketoreductase) (EC 1.1.1.210)
Cleaved into：
GeneID：100043456
Gene names (primary )：Hsd3b4
Gene names (synonym )：
Gene names (ORF )：
Length：373
Mass：41766
Sequence：MPGWSCLVTGAGGFLGQRIVRMLVQEEELQEIRALFRTFGRKQEEELSKLQTKTKVTVLKGDILDAQCLKRACQGMSAVIHTAAAIDPLGAASRQTILDVNLKGTQLLLDACVEANVPTFIYSSSVLVAGPNSYKEIILNAHEEEHHESTWSNPYPYSKKMAEKAVLAANGSILKNGGTLHTCALRLSFIYGEECQVTSTTVKTALKNNSIIKKNATFSIANPVYVGNAAWAHILAARSLQDPKKSPSIQGQFYYITDDTPHQSYDDLKCTLSKEWGLRLDTSWSLPLPLLYWLAFLLETVSFLLRPVYNYRPPFNRLLITVLNSVFTFSYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLVMQHREIGNKKSQ
Tissue specificity：Kidney (at protein level); found only in the cortex, appears to be associated with the proximal tubules; and a minor expression in testis. {ECO:0000269|PubMed:8145763}.
Induction：
Developmental stage：Expression between 15-20 days post-implantation occurs only in the kidney of the male fetus and not in the female, whereas a similar expression is found in adult male and female kidneys. {ECO:0000269|PubMed:8145763}.
Protein families：3-beta-HSD family