K1C12_MOUSE Q64291
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64291
Recommended name:Keratin, type I cytoskeletal 12
EC number:
Alternative names:(Cytokeratin-12) (CK-12) (Keratin-12) (K12)
Cleaved into:
GeneID:
Gene names (primary ):Krt12
Gene names (synonym ):Krt1-12 Krt1.12
Gene names (ORF ):
Length:487
Mass:52464
Sequence:MSLSVCTSALSRRSSSQNGAAGRPWGASASSVAGGYGGSASGFGVGCGGLFSAASMFGSSSGFSGGSAGCLPGLGSAYGGPLRGGAGGMGIGMGIAGSSGGGSLCIFSGNDGGLLSGSEKETMQNLNDRLASYLGKVRSLEEANAELENKIREWYETRRTRDAGSQSDYSKYYPLIEDLKNKIVSARVSNAQLLLQIDNARLAAEDFRMKYENELALRQTVEADINGLRRVLDELTLTRADLEAQLETLTEELAYMKKNHEEELQSFQAGGPGEVNVEMDAAPGVDLTKVLNEMRAQYEAMAEQNRKDAEAWFLEKSGELRKEISSNTEQLQSSKSEVTDLKRMVQNLEIELQSQLAMKSSLEGSLAETEGGYCCQLSQVQQLIGSLEEQLQQVRADAERQNADHQRLLGVKARLEMEIETYRRLLEGDSQGDGFDESSSLSVSKPQTPSVDSSKDPNKTRKIKTVVQEIVNGEVVSSQVQELEEEM
Tissue specificity:Expressed in the corneal epithelium (at protein level) (PubMed:7508359, PubMed:8977471, PubMed:26758872). Also expressed in the suprabasal limbal epithelium of the cornea (at protein level) (PubMed:7508359). {ECO:0000269|PubMed:26758872, ECO:0000269|PubMed:7508359, ECO:0000269|PubMed:8977471}.
Induction:Expression is retarded by epidermal growth factor (EGF). {ECO:0000269|PubMed:7508359}.
Developmental stage:Expression commences in corneal peridermal epithelium in the embryo at 15.5 dpc (PubMed:16431949). Between 15.5 dpc and postnatal day 4 (P4), expression is restricted to the suprabasal and/or superficial cells when the corneal epithelium begins to stratify (PubMed:7508359, PubMed:16431949). At P30 expression is sporadically detected in the basal corneal epithelium and the number of positive basal cells increases as the mice grow older (PubMed:16431949). {ECO:0000269|PubMed:16431949, ECO:0000269|PubMed:7508359}.
Protein families:Intermediate filament family