ACKR3_MOUSE P56485
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P56485
Recommended name：Atypical chemokine receptor 3
EC number：
Alternative names：(C-X-C chemokine receptor type 7) (CXC-R7) (CXCR-7) (Chemokine orphan receptor 1) (G-protein coupled receptor RDC1 homolog) (RDC-1)
Cleaved into：
GeneID：12778
Gene names (primary )：Ackr3
Gene names (synonym )：Cmkor1 Cxcr7 Rdc1
Gene names (ORF )：
Length：362
Mass：41636
Sequence：MDVHLFDYAEPGNYSDINWPCNSSDCIVVDTVQCPTMPNKNVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVITIPVWVVSLVQHNQWPMGELTCKITHLIFSINLFGSIFFLACMSVDRYLSITYFTGTSSYKKKMVRRVVCILVWLLAFFVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVILGFAVPFTIIAIFYFLLARAMSASGDQEKHSSRKIIFSYVVVFLVCWLPYHFVVLLDIFSILHYIPFTCQLENVLFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQNTK
Tissue specificity：Not detected in blood, liver, lung and heart, but high expression detected in several tumor cell lines (at protein level). Expressed in heart, spleen, kidney, lung, ovary, brain, testis, astrocytes, neutrophils and B-lymphocytes. {ECO:0000269|PubMed:16940167, ECO:0000269|PubMed:17804806, ECO:0000269|PubMed:9510554}.
Induction：
Developmental stage：Expression detected after 9.5 dpc in the endothelial layer of the forming heart, neural tube, brain and septum transversum. At 10.5 dpc, expressed at high levels in the prosencephalon and in a part of the rhombencephalon and at lower levels in the neural tube, somites and heart. Detected in liver at 11 dpc and 13 dpc, but not at 15 dpc and 17 dpc. During heart development, expression detected mainly in endocardial cells and endocardial cushion mesenchymal cells in both outflow tract and atrioventricular canal regions and to a lesser degree in myocardial cells at 10.5 dpc, in the mesenchyme of the forming valves and in numerous microvessels in the myocardium at 12.5 dpc, and from 14.5 dpc onward mainly in the microvasculature associated with myocardium, valves and great vessels. In developing telencephalon, observed at 11.5 dpc in the ventral telencephalon in proliferative zones of the medial ganglionic eminence (MGE), in ventral part of the lateral ganglionic eminence (LGE) and in Cajal-Retzius (CR) neurons of dorsal telencephalon. At 12.5 dpc, detected in migrating olfactory tubercle neuron precursors and cortical interneurons, and in CR cells and subplate neurons of the cortex. At 13.5 dpc, observed in the germinal zone of MGE in the subpallium, in the marginal zone and cortical subventricular zone (SVZ) of the lateral cortex as well as in pyramidal cells and tangentially migrating interneurons. At postnatal stages, expressed in postnatal cortical plate and in migrating olfactory bulb interneurons in the striatal SVZ and rostral migratory stream. {ECO:0000269|PubMed:16940167, ECO:0000269|PubMed:17804806, ECO:0000269|PubMed:20681075, ECO:0000269|PubMed:21220100, ECO:0000269|PubMed:21246655}.
Protein families：G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily