WNT8A_MOUSE Q64527
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64527
Recommended name：Protein Wnt-8a
EC number：
Alternative names：(Protein Wnt-8d) (Stimulated by retinoic acid gene 11 protein)
Cleaved into：
GeneID：20890
Gene names (primary )：Wnt8a
Gene names (synonym )：Stra11 Wnt8d
Gene names (ORF )：
Length：354
Mass：39573
Sequence：MGHLLMLWVAAGMCYPALGASAWSVNNFLITRPKAYLTYTASVALGAQIGIEECKFQFAWERWNCPEHAFQFSTHNRLRAATRETSFIHAIRSAAIMYAVTKNCSMGDLENCGCDESQNGKTGGHGWIWGGCSDNVEFGEKISRLFVDSLEKGKDARALVNLHNNRAGRLAVRASTKRTCKCHGISGSCSIQTCWLQLADFRQMGNYLKAKYDRALKIEMDKRQLRAGNRAEGRWALTEAFLPSTEAELIFLEGSPDYCNRNASLSIQGTEGRECLQNARSASRREQRSCGRLCTECGLQVEERRAEAVSSCDCNFQWCCTVKCGQCRRVVSRYYCTRPVGSARPRGRGKDSAW
Tissue specificity：
Induction：By retinoic acid. {ECO:0000269|PubMed:8887323}.
Developmental stage：Expression in early stages of embryogenesis. Expression begins in the posterior region of early primitive streak-stage embryos and after it spreads into the embryonic ectoderm up to a sharp rostral boundary at the base of the developing headfolds. Expressed transiently in the newly formed mesoderm. Expression is down-regulated during somitogenesis. The expression is highly restricted during gastrulation and neurulation, both temporally and spatially.
Protein families：Wnt family