LITAF_MOUSE Q9JLJ0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JLJ0
Recommended name：Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog
EC number：
Alternative names：(LPS-induced TNF-alpha factor homolog) (Estrogen-enhanced transcript protein) (mEET) (LITAF-like protein) (NEDD4 WW domain-binding protein 3)
Cleaved into：
GeneID：56722
Gene names (primary )：Litaf
Gene names (synonym )：N4wbp3 Tbx1
Gene names (ORF )：
Length：161
Mass：16946
Sequence：MSAPGPYQAAAGPSVVPTAPPTYEETVGVNSYYPTPPAPMPGPATGLITGPDGKGMNPPSYYTQPVPVPNANAIAVQTVYVQQPVSFYDRPVQMCCPSCSKMIVTQLSYNAGALTWLSCGSLCLLGCVAGCCFIPFCVDALQDVDHYCPNCKALLGTYKRL
Tissue specificity：Detected in brain, heart, lung, liver, spleen and bone marrow (PubMed:22160695). Detected in myelinating Schwann cells in sciatic nerve and in bone marrow-derived macrophages (at protein level) (PubMed:22729949). Widely expressed. Highly expressed in liver. {ECO:0000269|PubMed:12355436, ECO:0000269|PubMed:15025820, ECO:0000269|PubMed:22160695, ECO:0000269|PubMed:22729949}.
Induction：Up-regulated in macrophages exposed to lipopolysaccharide (LPS) (at protein level) (PubMed:15793005). By estrogen and lipopolysaccharides (LPS). {ECO:0000269|PubMed:12355436, ECO:0000269|PubMed:15025820, ECO:0000269|PubMed:15793005}.
Developmental stage：Expression in sciatic nerve is low in neonates, culminates seven days after birth and decreases rapidly thereafter (at protein level) (PubMed:22729949). Strong expression is detected at E.7 and drops at 11 dpc. {ECO:0000269|PubMed:15025820, ECO:0000269|PubMed:22729949}.
Protein families：CDIP1/LITAF family