PCDP1_MOUSE A9Q751
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:A9Q751
Recommended name：Cilia- and flagella-associated protein 221
EC number：
Alternative names：(Primary ciliary dyskinesia protein 1)
Cleaved into：
GeneID：226356
Gene names (primary )：Cfap221
Gene names (synonym )：Gm101 Pcdp1
Gene names (ORF )：
Length：836
Mass：96956
Sequence：MEVVKSPMQELQQAKEPFDTMSPLLLKSLVEEPKKRTEVPNHLLESRVYAKLLNNKVIQARPGIVHFGGYEIESKHQQILNIANISDEDTHLHILPPQTKYFQINFEKKEHRLIPGLSLTVTITFSPDEWRYYYDCIRIHCKGDDTLLVPIHAYPVLNNLDFPTFINLSDVFLGESKSYVIPLQCSCPVDFEFHITLLRSHQAFTIEPKSGIIPANGKAKVTVKFTPIQYGMAQIKIQLWISQFNSQPYECVFTGTCYPNMALPLEEFKRLNTRSKKVNVPLEKTTYVQFYPAPAKAKPQKLKEIDYQDLRFPADLSNPFAVATVLNQEPGKLKIKELKQVLDQGDEISKTRQMKEAIFEQKVRQDILTEIENHLKWQVHLGKEHTTYRFKRELTEEWKKARAKYKQNRGDPVEGEELQRLQTEQSQKRIVRDLKGKRQEFHPNFDPLVNNVWLTRHRAQRRFQQAARKIMLERRLLSMLGAIRGMDKESILRKIIQVNGKLIQGENPSRGRRAHLKQEDNIWRYSLESEEVLHFAFPTDSESYNELALDGLGLVPIKSPEIQIKHSYPYFTLKVPQLYKIKGYHPFSVNKSSTNYRLQKLARPLKHGAEDEVTTIITIPKKDTTPLSAKPSILSMKPPEGLAMSVEYDPLYIFNPSPGLFAVKHPLTYAETLIDYHLCSHPKYKYTQESHMGSSIPLTQRQFLHHTDIIPGIMNWKKFQPLVFSSMSDPSMVEATQRSDWYSSVMLPIDVPAPLEDLPEEDRLETTERDLCDQGIEVMLTPEMVQVEFPMLIHRDSKKEKDFKDSTQLPEKVGERVQEEMKNLRSKALNTYLILD
Tissue specificity：Expressed in testis, specifically in developing spermatocytes and spermatids but not in immature spermatogonia. Expressed in the ciliated respiratory epithelial cells lining the sinuses, trachea and bronchi (at protein level). {ECO:0000269|PubMed:15613475, ECO:0000269|PubMed:18039845}.
Induction：
Developmental stage：Expression in testis starts at P20. {ECO:0000269|PubMed:15613475}.
Protein families：PCDP1 family