SPR2F_MOUSE O70557
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O70557
Recommended name:Small proline-rich protein 2F
EC number:
Alternative names:
Cleaved into:
GeneID:20760
Gene names (primary ):Sprr2f
Gene names (synonym ):
Gene names (ORF ):
Length:76
Mass:8271
Sequence:MSYQEQQCKQPCQPPPVCPPPKCPEPCSPSVCPEPCPPPKCPEPCPEPCPPPSFQQKCPPVQPPPPCQQKCPPKSK
Tissue specificity:Expressed in uterus. {ECO:0000269|PubMed:15232223}.
Induction:Up-regulated by estrogen in the uterus of ovariectomized animals, with strongly increased expression detected in luminal epithelial and stromal cells at 6 and 12 hours after hormone injection. {ECO:0000269|PubMed:15232223}.
Developmental stage:Expression in uterus varies during the estrous cycle, with highest levels during proestrus and estrus stages and declining sharply from metestrus to diestrus. During early pregnancy, uterine expression is markedly increased at 1 dpc, declines rapidly at 2 dpc and is almost undetectable from 3 dpc to 6 dpc. {ECO:0000269|PubMed:15232223}.
Protein families:Cornifin (SPRR) family