PR8A6_MOUSE   Q9DAY2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DAY2

Recommended name:Prolactin-8A6

EC number:

Alternative names:(Placental prolactin-like protein C1) (PLP-C1) (PRL-like protein C1) (Prolactin-like protein C-alpha) (PLP C-alpha) (Prolactin-like protein C)

Cleaved into:

GeneID:19112

Gene names  (primary ):Prl8a6

Gene names  (synonym ):Prlpc Prlpc1

Gene names  (ORF ):

Length:240

Mass:27274

Sequence:MALLLSQPHFSGPLLLLVVSNLLLWEKAASNLPCVAEEGGCWNPLLETFNSATQKAETLHNLADQLYVELYYNQFSSGQFWDFSSQIIRQDKTVVRAGSYCHSSLTNPPNTGVHINIEIASYLKTLINFVGSWISPLFHLVIELSATKDVPETILSKAKEIEENNRQILSDLRWILTKVSPAAEMTEEFPHWEYLSFLKSSDKNNKFLAMFNLSYCIDHDSKYILLQLRLLKCLITGKDC

Tissue specificity:Expressed specifically in the spongiotrophoblast and trophoblast giant cells from the junctional zone of the chorioallantoic placenta. {ECO:0000269|PubMed:9832456}.

Induction:

Developmental stage:Expression increased from midgestation to the end of the pregnancy. {ECO:0000269|PubMed:9832456}.

Protein families:Somatotropin/prolactin family


   💬 WhatsApp