SNG3_MOUSE   Q8R191


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R191

Recommended name:Synaptogyrin-3

EC number:

Alternative names:

Cleaved into:

GeneID:20974

Gene names  (primary ):Syngr3

Gene names  (synonym ):

Gene names  (ORF ):

Length:229

Mass:24561

Sequence:MEGASFGAGRAGAAFDPVSFARRPQTLLRVVSWVFSIAVFGPIVNEGYVNSDSGPELRCVFNGNAGACRFGVVLGLGAFIACVAFLLLDVRFQQISSVRDRRRAVLLDLGFSGVWSFLWFVGFCFLTNQWQRTTPGPGTAQAGDAARAAIAFSFFSILSWVALTVKALQRFRLGTDMSLFATDQLGTGAAQAYPGYPVGSGVEGTETYQSPPFTETLDTSSKGYQVPAY

Tissue specificity:Specifically expressed in brain. Found in the brain across the dorsal and ventral corpus striatum as well as in the cortex. {ECO:0000269|PubMed:10383386, ECO:0000269|PubMed:19357284}.

Induction:

Developmental stage:Expression increases during brain development from P2 to adult (at protein level). {ECO:0000269|PubMed:10383386}.

Protein families:Synaptogyrin family


   💬 WhatsApp