LY6H_MOUSE   Q9WUC3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9WUC3

Recommended name:Lymphocyte antigen 6H

EC number:

Alternative names:(Ly-6H)

Cleaved into:

GeneID:23934

Gene names  (primary ):Ly6h

Gene names  (synonym ):

Gene names  (ORF ):

Length:139

Mass:14669

Sequence:MLPAAMKSLGLALLALLLCPSPAHGLWCQDCTLANSSHCAPKQCQPTDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGASVAGRSPWALAGGLLLSLGPALLWAGP

Tissue specificity:Strongly expressed in brain, also found in lower levels in eye and reproductive tissues.

Induction:

Developmental stage:Expression increases during embryonic development.

Protein families:


   💬 WhatsApp