A1AT6_MOUSE Q9DCQ7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DCQ7
Recommended name：Alpha-1-antitrypsin 1-6
EC number：
Alternative names：(Alpha-1 protease inhibitor 6) (Alpha-1-antiproteinase) (Serine protease inhibitor 1-6) (Serine protease inhibitor A1f) (Serpin A1f)
Cleaved into：
GeneID：68348
Gene names (primary )：Serpina1f
Gene names (synonym )：
Gene names (ORF )：
Length：411
Mass：46337
Sequence：MTTPFSSHGLLLLVGLCCLLLITKTKHEKLYEDPSIDPFQCRKVALTICNVSITLFKKMAQLSGNGNILFSPIRVIAAISMLSLGSNGNLSKHILETLRFNKTGLPEAEIHKCFWYLLHSIHQTEETSSLQTGSSVFIHQDLTSVDKFVKGVKELYHSDMISINFTDSSQAKTQINNYVMEISQKAIVNIVKNLESDTFLAVVNYIIWNAKLDSNFGCRSVKVKDYHLGYGMTIKVPMIHNMAMHYLFRVGDLSSTVLMLTLLTGNFATYFIIPDPGKMQKVEQSLTYPHFRRMRRQLLTRLVDLEIPELSLSETHDLESMMSLLGITYVFNSGTNSSDMNDTLQKSFKVVSKAVLTIDEKGSKPSTNSCFKKLGSTDMGRMQLNRPFLIFIQDHTNDVPLFLGRVVNPQN
Tissue specificity：Expressed predominantly in epididymis where it is found in the epithelial cells of the caput, corpus and cauda epididymis. {ECO:0000269|PubMed:16707773}.
Induction：Expression decreases following castration. Administration of testosterone restores expression levels. {ECO:0000269|PubMed:16707773}.
Developmental stage：Expression increases gradually from post-natal day 1 to week 2, increases significantly from week 2 to week 4 and remains high thereafter. {ECO:0000269|PubMed:16707773}.
Protein families：Serpin family