ZFP58_MOUSE P16372
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P16372
Recommended name：Zinc finger protein 58
EC number：
Alternative names：(Zfp-58) (Regulator of sex-limitation candidate 5) (Zinc finger protein Mfg-1)
Cleaved into：
GeneID：238693
Gene names (primary )：Zfp58
Gene names (synonym )：Mfg-1 Rslcan5 Zfp817
Gene names (ORF )：
Length：489
Mass：57232
Sequence：MLSFWDVAIDFSPEERECLEPDQWDLYRDVMLENYSHLDFLGLALSKPFLVTFLEQRQGPWDVKRQAAAAVHPGKTVNKCKDFSKAFFCKSLLTQHQRIRTGEKAFKCEECGKAFNNRSNLSEHKRIHTGEKPYKCEECGKAFRIRSKLSTHQRVHTGEKPYKCEECGKAFNSHSNLSEHKRIHTGEKPYKCEECGKAFSTRSTYYRHQKNHTGKKPYKCEECAKEFSYPSLLKVHQRIHSAEKSYKCEECGKPFYCPLLLKKHQIIHSAEKPYKCAECGKAFHYPSLLKRHQRIHAGKKPCKCKDCDRAFYSSAFLKRHQRIHSEENSYKCGECGKRFCSFPHLQYHQRFHSGEKPYKCEQCGKTFSTLSYLPWHKLRHSGEKSYKCEKCGKMFYSTLDLKKHQKIHEYKCGECHYGFPNYAALTAHQRVHTGEKPHVCEQCGKDFSRIDSLNQHQLVHTGEKPYKCEKCGKCFYRSSSLKRHQGIHS
Tissue specificity：Expressed in liver, testis and, at considerably lower levels, in brain, spleen and heart. {ECO:0000269|PubMed:2512579}.
Induction：
Developmental stage：Expression increases upon differentiation and is not related to the cell cycle. {ECO:0000269|PubMed:2512579}.
Protein families：Krueppel C2H2-type zinc-finger protein family