ATOH7_MOUSE Q9Z2E5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z2E5
Recommended name：Protein atonal homolog 7
EC number：
Alternative names：(Helix-loop-helix protein mATH-5) (mATH5)
Cleaved into：
GeneID：53404
Gene names (primary )：Atoh7
Gene names (synonym )：Ath5
Gene names (ORF )：
Length：149
Mass：16569
Sequence：MKSACKPHGPPAGARGAPPCAGAAERAVSCAGPGRLESAARRRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIIALTRILAEAERDWVGLRCEQRGRDHPYLPFPGARLQVDPEPYGQRLFGFQPEPFPMAS
Tissue specificity：Expressed in retinal ganglion cells. {ECO:0000269|PubMed:26392540}.
Induction：
Developmental stage：Expression initiates at 11 dpc in the central optic cup and is detected in retinal progenitor cells until birth (PubMed:9806930). In addition to the eye, only expressed in the developing tenth cranial ganglion between 13.5 dpc and 15.5 dpc (PubMed:9806930). {ECO:0000269|PubMed:9806930}.
Protein families：