SPT25_MOUSE Q9DA57
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DA57
Recommended name：Spermatogenesis-associated protein 25
EC number：
Alternative names：(Testis-specific gene 23 protein)
Cleaved into：
GeneID：75642
Gene names (primary )：Spata25
Gene names (synonym )：Tsg23
Gene names (ORF )：
Length：226
Mass：23548
Sequence：MSYFVSPQSHLGLLPSGQGGAASSGSSLGLYSPAEPVVVAPGGLGPLSQKAEQVAPAAQAWGPTLAVPEARGCSGGVSWETPRRKEHNRYCPKLPPMRPLESLGWADPCSRSRAPYLGGPSRPRPLLLCGLSPGVLPISSEAGGKEAASQPDICILTLAMMIAGIPTVPVPGLREEDLIRAAQAFMMAHPEPEGAVEGVQWEQAHAHAHMASGQMPLVRSRRGSCL
Tissue specificity：Expressed strongly in testis, weakly in epididymis and not detected in other tissues. {ECO:0000269|PubMed:19240080}.
Induction：
Developmental stage：Expression is detected at day 15 after birth and gradually increases from day 15 to 5 months. Expression is found in round spermatids with little expression in spermatogonia. {ECO:0000269|PubMed:19240080}.
Protein families：SPATA25 family