NTNG2_MOUSE Q8R4F1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R4F1
Recommended name：Netrin-G2
EC number：
Alternative names：(Laminet-2)
Cleaved into：
GeneID：171171
Gene names (primary )：Ntng2
Gene names (synonym )：Lmnt2
Gene names (ORF )：
Length：589
Mass：66166
Sequence：MLRLLALFLHCLPLVSGDYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGITCGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDREDEGLATYWQSVTWSRYPSPLEANITLSWNKSVELTDDVVVTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSARRARDMSPSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRMESAKGLKEFFTFTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCTVREGSLQCECEHNTTGPDCGRCKKNFRTRAWRAGSYLPLPHGSPNACAAAGSAFGSQTKPPTMAPLGDSSFWPQVSSSAEAVAISVAVPSQAKDSTLFELKPRSPQVIPIEEFQDCECYGHSNRCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSVHDRCNETGFCECREGAVGPKCDDCLPTHYWRQGCYPNVCDDDQLLCQNGGTCQQNQRCACPPGYTGIRCEQPRCDLADDAGPDCDRAPGIVPRPDTLLGCLLLLGLAARLAC
Tissue specificity：Expression is restricted primarily to neurons of the CNS, particularly in the cerebral cortex, habenular nucleus and superior colliculus. Low levels in lung, kidney, heart and spleen. {ECO:0000269|PubMed:11804778, ECO:0000269|PubMed:11906208}.
Induction：
Developmental stage：Expression is detected from embryonic day 9. Strong expression is maintained from embryonic day 14 well into adulthood. {ECO:0000269|PubMed:11804778}.
Protein families：