FGFP3_MOUSE Q1HCM0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q1HCM0
Recommended name：Fibroblast growth factor-binding protein 3
EC number：
Alternative names：(FGF-BP3) (FGF-binding protein 3) (FGFBP-3)
Cleaved into：
GeneID：72514
Gene names (primary )：Fgfbp3
Gene names (synonym )：
Gene names (ORF )：
Length：245
Mass：26217
Sequence：MSPPRPRASLSPLTLLLLLGGCLLSAAGRDKGAAGREVTRASRPTVGSSGRFVSPEQHACSWQLLVPAPGTPTGGELALRCQTPGGASLHCAYRGHPERCAATGARRAHYWRRLLGALRRRPRPCLDPAPLPPRLCARKTAGSDLHSPAHPSLPARPSEPPRSRARSPARSRQSVRSPSSQPEKKPLLVKSNSGGRKAGSDPVPEPPAAAGFQPNGLDQNAELTETYCTEKWHSLCNFFVNFWNG
Tissue specificity：In the adult, highly expressed in brain with lower levels in ovary. In the embryo, highest levels are found in the brain and spinal cord at 14 dpc and expression is almost completely restricted to the brain by 18 dpc. In the adult and postnatal brain, highly expressed in the orbitofrontal cortex where it is concentrated primarily in differentiated neurons. {ECO:0000269|PubMed:20851768}.
Induction：
Developmental stage：Expression is first detected at 10 dpc and reaches a peak at birth. After birth, levels decrease and remain constant throughout postnatal development. {ECO:0000269|PubMed:20851768}.
Protein families：Fibroblast growth factor-binding protein family