GSDMA_MOUSE Q9EST1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9EST1
Recommended name：Gasdermin-A
EC number：
Alternative names：(Gasdermin-1) (Gasdermin-A1)
Cleaved into：Gasdermin-A, N-terminal (GSDMA-NT); Gasdermin-A, C-terminal (GSDMA-CT)
GeneID：57911
Gene names (primary )：Gsdma
Gene names (synonym )：Gsdm Gsdm1 Gsdma1
Gene names (ORF )：
Length：446
Mass：49593
Sequence：MTMFENVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVHTDYTLLDVLEPGSSPSDPTDSGNFSFKNMLDARVEGDVDVPKTVKVKGTAGLSRSSTLEVQTLSVAPTALENLHKERKLSADHPFLKEMRERGENLYVVMEVVETLQEVTLERAGKAEGCFSLPFFAPLGLQGSVNHKEAVTIPKGCVLAYRVRQLMVNGKDEWGIPHICNDSMQTFPPGEKPGEGKFILIQASDVGEMHEDFKTLKEEVQRETQEVEKLSPVGRSSLLTSLSHLLGKKKELQDLEQTLEGALDKGHEVTLEALPKDVLLSKDAMDAILYFLGALTVLSEAQQKLLVKSLEKKILPVQLKLVESTMEKNFLQDKEGVFPLQPDLLSSLGEEELILTEALVGLSGLEVQRSGPQYTWDPDTLPHLCALYAGLSLLQLLSKNS
Tissue specificity：Expressed predominantly in the gastrointestinal (GI) tract and in the skin at a lower level. In the GI tract, the expression is highly restricted to the esophagus and forestomach. {ECO:0000269|PubMed:10967128, ECO:0000269|PubMed:17350798}.
Induction：
Developmental stage：Expression is first detected at 12.5 dpc. {ECO:0000269|PubMed:17350798}.
Protein families：Gasdermin family