DNSL3_MOUSE O55070
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O55070
Recommended name：Deoxyribonuclease gamma
EC number：EC 3.1.21.-
Alternative names：(DNase gamma) (DNase I homolog protein DHP2) (Deoxyribonuclease I-like 3) (DNase I-like 3) (Liver and spleen DNase) (LS-DNase) (LSD)
Cleaved into：
GeneID：13421
Gene names (primary )：Dnase1l3
Gene names (synonym )：
Gene names (ORF )：
Length：310
Mass：35760
Sequence：MSLHPASPRLASLLLFILALHDTLALRLCSFNVRSFGASKKENHEAMDIIVKIIKRCDLILLMEIKDSSNNICPMLMEKLNGNSRRSTTYNYVISSRLGRNTYKEQYAFVYKEKLVSVKTKYHYHDYQDGDTDVFSREPFVVWFHSPFTAVKDFVIVPLHTTPETSVKEIDELVDVYTDVRSQWKTENFIFMGDFNAGCSYVPKKAWQNIRLRTDPKFVWLIGDQEDTTVKKSTSCAYDRIVLCGQEIVNSVVPRSSGVFDFQKAYDLSEEEALDVSDHFPVEFKLQSSRAFTNNRKSVSLKKRKKGNRS
Tissue specificity：Expressed at high levels in liver, spleen and testes. Expressed at lower levels in heart, lungs, skeletal muscle and kidney. Not expressed in brain. Predominantly expressed in macrophages; at protein level. Secreted by mononuclear phagocytes. {ECO:0000269|PubMed:10807908, ECO:0000269|PubMed:12050166, ECO:0000269|PubMed:12095301, ECO:0000269|PubMed:27293190}.
Induction：
Developmental stage：Expression is first detected at embryonic day 11, and higher amounts were detected at days 15 and 17. {ECO:0000269|PubMed:10807908}.
Protein families：DNase I family