CHP3_MOUSE Q9JKL5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JKL5
Recommended name：Calcineurin B homologous protein 3
EC number：
Alternative names：(Tescalcin) (TE-1) (TSC)
Cleaved into：
GeneID：57816
Gene names (primary )：Tesc
Gene names (synonym )：Chp3
Gene names (ORF )：
Length：214
Mass：24600
Sequence：MGAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNPIRSKIVRAFFDNRNLRKGSSGLADEINFEDFLTIMSYFRPIDTTLGEEQVELSRKEKLKFLFHMYDSDSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCVGQMEPDQVYEGITFEDFLKIWQGIDIETKMHIRFLNMETIALCH
Tissue specificity：Expressed in embryonic, newborn and adult testis, but not in prepubertal testis. Expressed in the embryonic testis during testis determination but is not expressed at any time in the embryonic ovary. In embryonic testis, expression is restricted to the testis cords and is seen in both Sertoli cells and germ cells. Expression is excluded from the myoid cells which surround the cords. Expressed in the embryonic adrenal after the initial stages of differentiation. Expressed at a lower level in the embryonic brain, heart and lung but not in liver or gut. May be expressed at a very low level in the embryonic kidney. In the embryonic brain, expressed in the nasal placode and in fibers extending from the olfactory epithelium to the primordial olfactory bulb. In adults, expressed in the heart, and weakly in the brain and kidney. Highly expressed in terminally differentiated megakaryocytes (at protein level). Not detected in fetal liver cells (at protein level). {ECO:0000269|PubMed:11145610, ECO:0000269|PubMed:14661968, ECO:0000269|PubMed:17717601, ECO:0000269|PubMed:19345287}.
Induction：
Developmental stage：Expression is first detected in the male gonad at 11.5 dpc, peaks at 14.5 dpc, declines slightly by 15.5 dpc, and continues to at least 17.5 dpc. {ECO:0000269|PubMed:11145610}.
Protein families：Calcineurin regulatory subunit family, CHP subfamily