RFLA_MOUSE Q7TS73
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7TS73
Recommended name：Refilin-A
EC number：
Alternative names：(Regulator of filamin protein A) (RefilinA)
Cleaved into：
GeneID：73121
Gene names (primary )：Rflna
Gene names (synonym )：Cfm2 Fam101a
Gene names (ORF )：
Length：204
Mass：22606
Sequence：MVGHLHLQAMGDTREQSRDGLLDSPDSGLPPSPSPSPPFYALSPGTLDTRTTTEAPAAPSLFQTPPALEMRSRLLPVFFGESIEVDPEPAHEIRCNSEITYASERYFRDKIFYAPVPTVTAYSETIVAAPNCTWRSYRSQLTLEPRPRALRFGSTAIIFPKLARSSFRTTLHCSLGQPRHWYSSSLQLRRCGDPTPGPSCPDVL
Tissue specificity：Detected in various tissues, with highest expression in lung, followed by spleen. {ECO:0000269|PubMed:24436304}.
Induction：Up-regulated during chondrocyte differentiation. {ECO:0000269|PubMed:24436304}.
Developmental stage：Expression is first detected in the marginal zone of the vertebral primordia at 12.5 dpc. Expression is subsequently observed during skeletal development in the cartilaginous elements including the vertebral bodies, carpal bones, femora, ribs and caudal vertebrae. At 18.5 dpc, expression is increased in the layers of proliferating and prehypertrophic chondrocytes. Furthermore, expression is also observed in intervertebral disk, including nucleus pulposus and annulus fibrosus, during skeletal development. {ECO:0000269|PubMed:24436304}.
Protein families：Refilin family