SPEF1_MOUSE   Q99JL1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99JL1

Recommended name:Sperm flagellar protein 1

EC number:

Alternative names:(Calponin-homology and microtubule-associated protein)

Cleaved into:

GeneID:70997

Gene names  (primary ):Spef1

Gene names  (synonym ):Clamp

Gene names  (ORF ):

Length:234

Mass:26839

Sequence:MESSVDEEALHQLYLWVDNIPLSRPKRNLSRDFSDGVLVAELIKFYFPKMVEMHNYVPANSLQQKLSNWGHLNRKVLNKLNFSVPDDVMRKIAQCSPGVVELVLIPLRQRLEERQRRQKLGVGSLQELAPQDSSGYMDMGLPQKVRGEGAPALGEQLREGRPLASRPPGYNQALQGDPSFVLQIAEKEQELLASQETVQVLQMKVKRLEHLLQLKNVRIDDLSRRLQQAERKQR

Tissue specificity:Expressed predominantly in the seminiferous epithelium of adult testis (PubMed:15979255). Expressed in pillar cells of the organ of Corti (at protein level). Expressed in brain, kidney, lung and testis (PubMed:16206169, PubMed:30535028). Highly expressed in the trachea, lung and oviduct (PubMed:30535028). {ECO:0000269|PubMed:15979255, ECO:0000269|PubMed:16206169, ECO:0000269|PubMed:30535028}.

Induction:

Developmental stage:Expression is first detected in the testis at 3 weeks and continues to adulthood. {ECO:0000269|PubMed:15979255}.

Protein families:


   💬 WhatsApp